PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 483aa    MW: 55397.2 Da    PI: 8.2458
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493377.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3491.1e-151694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k+g l +p  f+ ++  g ++   +  +  + g++W+vk+  ++++    l++GW++F+++++L+ gD++vF++dg++ef   v +f++
  XP_016493377.1 16 PGFKQG-LNIPVGFL-KYlTGHEH---EHAVLKRAGKKWQVKV--NGRR----LEEGWEKFAEEHDLQLGDMLVFRHDGNMEF--EVVIFDS 94
                    455555.9*******.66554533...4577889*********..8888....**************************9999..7777775 PP

2B347.33.6e-15135217490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      +++s+  ++g l lpk+fa ++++ + ++  l+++des r W+++l    +++r+ + + WkeF  an+Lk+g+ ++F+++++  +
  XP_016493377.1 135 CTVRSYWVSNGYLFLPKQFALANSLTN-KNCGLIIRDESQRPWNLRL--ATYRSRVCIVGRWKEFIVANDLKVGECIMFEVVNNG-E 217
                     56789999***************5543.33469**************..99999**************************88753.3 PP

3B351.51.9e-16257337588
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     +++++ l++g l+lp +fa+++g+ + ++  l++ de+ r+W+++l    +++++ + +GW+eF  an+Lk+gD ++F+++ + 
  XP_016493377.1 257 TVKPYFLTKGYLRLPMQFARANGLTN-KNCGLIISDETQRRWNLRL--ATYGSQVCIVGGWNEFHAANDLKVGDCIMFEVVTNG 337
                     5679999***************7664.4457999************..999999*************************87643 PP

4B359.46.5e-19378461592
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     ++++++l++++l++pk+fa ++g+ + ++ +l+++de  rsW+v+l  +  ++++++++GW eF +a+ LkegD ++F+l+ + + ++
  XP_016493377.1 378 TVRPYYLSNDLLYIPKQFALANGLTN-KKCDLIIRDELQRSWNVRL--CSFGNSVFIRGGWHEFRNAKCLKEGDCIMFELVTN-GNRP 461
                     67899*****************8885.4569***************..888888*************************9874.4444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-22497IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.844795IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-20797IPR015300DNA-binding pseudobarrel domain
CDDcd100172.81E-17893No hitNo description
SMARTSM010191.3E-171095IPR003340B3 DNA binding domain
PfamPF023622.7E-121994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.0E-15130223IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.6E-9132227IPR003340B3 DNA binding domain
PROSITE profilePS5086311.758132226IPR003340B3 DNA binding domain
SuperFamilySSF1019361.22E-17132224IPR015300DNA-binding pseudobarrel domain
PfamPF023626.8E-13135219IPR003340B3 DNA binding domain
CDDcd100174.20E-12138220No hitNo description
Gene3DG3DSA:2.40.330.102.5E-16249342IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-17252344IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.5E-12253348IPR003340B3 DNA binding domain
PROSITE profilePS5086312.788253347IPR003340B3 DNA binding domain
PfamPF023626.2E-14257339IPR003340B3 DNA binding domain
CDDcd100177.68E-12263332No hitNo description
Gene3DG3DSA:2.40.330.101.9E-21372466IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-21373467IPR015300DNA-binding pseudobarrel domain
CDDcd100179.63E-16374465No hitNo description
PROSITE profilePS5086312.858374468IPR003340B3 DNA binding domain
SMARTSM010195.8E-19375469IPR003340B3 DNA binding domain
PfamPF023624.0E-17377463IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MKVRPVKPHF FKPIQPGFKQ GLNIPVGFLK YLTGHEHEHA VLKRAGKKWQ VKVNGRRLEE  60
GWEKFAEEHD LQLGDMLVFR HDGNMEFEVV IFDSSHCDRE YAENLQEEEE EEEEGRGGEE  120
EQGEEANFGQ SLFECTVRSY WVSNGYLFLP KQFALANSLT NKNCGLIIRD ESQRPWNLRL  180
ATYRSRVCIV GRWKEFIVAN DLKVGECIMF EVVNNGEKPI WQFHVKPNPI IMSSRKAFPN  240
EESANHSPSG QSLLLLTVKP YFLTKGYLRL PMQFARANGL TNKNCGLIIS DETQRRWNLR  300
LATYGSQVCI VGGWNEFHAA NDLKVGDCIM FEVVTNGDKP IRKFYGKPNP SMKSSSKAFP  360
YAGTDTHKPF SRSHFVCTVR PYYLSNDLLY IPKQFALANG LTNKKCDLII RDELQRSWNV  420
RLCSFGNSVF IRGGWHEFRN AKCLKEGDCI MFELVTNGNR PILKFNGKIS GEDTNVIQGI  480
SEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766332.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X1
RefseqXP_016493377.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X1
TrEMBLK4CIB30.0K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-46B3 family protein